![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7BS_7B68879A9.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 106aa MW: 12158.1 Da PI: 10.5505 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 35.3 | 2.6e-11 | 15 | 66 | 5 | 56 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 kr +r NR +A rs +RK +i+eLe kv++L++e ++L +l +l+ + Traes_7BS_7B68879A9.2 15 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDS 66 899******************************************9998766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.4E-18 | 11 | 75 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 2.1E-10 | 12 | 64 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.726 | 13 | 76 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 8.0E-13 | 15 | 65 | No hit | No description |
SuperFamily | SSF57959 | 8.44E-13 | 15 | 65 | No hit | No description |
CDD | cd14703 | 1.08E-18 | 16 | 65 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MANERLAEIA LTDPKRVKRI LANRQSAARS KERKMRYIQE LEHKVQVLQT EATTLSAQLT 60 MLQRDSGGLA TQNNELKIRL QAMEQQAQLR DGMLLMVPFF ISFGEN |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB199586 | 1e-144 | AB199586.1 Hordeum vulgare HvIRO1 mRNA for basic leucine zipper transcription factor, partial cds, cultivar: Ehimehadaka no.1. | |||
GenBank | AK374525 | 1e-144 | AK374525.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3068B13. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003574872.1 | 3e-55 | PREDICTED: transcription factor RF2a-like | ||||
Swissprot | Q6S4P4 | 4e-42 | RF2B_ORYSJ; Transcription factor RF2b | ||||
TrEMBL | W5HUN3 | 5e-72 | W5HUN3_WHEAT; Uncharacterized protein | ||||
STRING | MLOC_75510.1 | 9e-57 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6247 | 36 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G38900.3 | 5e-48 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|