PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BS_7B68879A9.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 106aa    MW: 12158.1 Da    PI: 10.5505
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BS_7B68879A9.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.32.6e-111566556
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
                           kr +r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l +l+  +
  Traes_7BS_7B68879A9.2 15 KRVKRILANRQSAARSKERKMRYIQELEHKVQVLQTEATTLSAQLTMLQRDS 66
                           899******************************************9998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.4E-181175IPR004827Basic-leucine zipper domain
PfamPF077162.1E-101264IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.7261376IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.0E-131565No hitNo description
SuperFamilySSF579598.44E-131565No hitNo description
CDDcd147031.08E-181665No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
MANERLAEIA LTDPKRVKRI LANRQSAARS KERKMRYIQE LEHKVQVLQT EATTLSAQLT  60
MLQRDSGGLA TQNNELKIRL QAMEQQAQLR DGMLLMVPFF ISFGEN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1995861e-144AB199586.1 Hordeum vulgare HvIRO1 mRNA for basic leucine zipper transcription factor, partial cds, cultivar: Ehimehadaka no.1.
GenBankAK3745251e-144AK374525.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3068B13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574872.13e-55PREDICTED: transcription factor RF2a-like
SwissprotQ6S4P44e-42RF2B_ORYSJ; Transcription factor RF2b
TrEMBLW5HUN35e-72W5HUN3_WHEAT; Uncharacterized protein
STRINGMLOC_75510.19e-57(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62473650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.35e-48bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]